PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.0152s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 409aa    MW: 46193.8 Da    PI: 8.8952
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.0152s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-32225278255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Araha.0152s0010.1.p 225 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 278
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15222278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28223278IPR009057Homeodomain-like
TIGRFAMsTIGR015579.4E-24225278IPR006447Myb domain, plants
PfamPF002495.9E-7226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MSMEGVFLEK TKTNTTTTLP DLSLHISLPD IHQYHHNESS KESSRRSSQP EHNNRSSNFE  60
LSLSHHNHPT ARIFHCPDRR TLNLPHQQHY NNPIINGGSL HHQRVDQSEI SNLHRPIRGI  120
PVYHNRSFPF HQQNSPSSSL PSLGGGDLDQ ISILNSSSGY NNAYRSLQSS PRLKGVPLHH  180
HNHYGSVVGS SDSSSPHHHN HHHHHGMIRS RFLPKMPTKR SMRAPRMRWT SSLHARFVHA  240
VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK TTNKPAASSD GSGEEEMGIN  300
GNEVHHQSST DQRAQSDDTS LHQEIDISST QPRWSNSSRE TWPSSNNCSS DIDTMIRTSS  360
TSMISHYQRS SLQNQEQRSN DQAKRCGDLS CNNPSLEFTL GRPDWHEK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0301920.0AY030192.1 Arabidopsis thaliana clone A1-2 KANADI protein (KAN) mRNA, complete cds.
GenBankAY0486880.0AY048688.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI1 (KAN1) mRNA, complete cds.
GenBankBT0264360.0BT026436.1 Arabidopsis thaliana At5g16560 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568334.10.0transcription repressor KAN1
SwissprotQ93WJ90.0KAN1_ARATH; Transcription repressor KAN1
TrEMBLR0H7C90.0R0H7C9_9BRAS; Uncharacterized protein
STRINGAT5G16560.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.10.0G2-like family protein